BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00987 (454 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.3 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.3 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.3 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.3 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.3 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 5.4 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 21 7.1 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 7.1 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 21 7.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 1.3 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 89 RKMPLRRAVRYLKNVIEKKECIPFR 163 R +PLR AV ++ ++I +P R Sbjct: 59 RALPLRSAVEHIPDLIADSRRLPLR 83 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 139 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQEIR 243 K+ + +PS +R W C A W GSL + R Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSSR 152 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 139 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQEIR 243 K+ + +PS +R W C A W GSL + R Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSSR 152 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 139 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQEIR 243 K+ + +PS +R W C A W GSL + R Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSSR 152 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +1 Query: 139 KERVYSIPSLQRRRWSLCSSKAVW-HNTGSLAQEIR 243 K+ + +PS +R W C A W GSL + R Sbjct: 117 KQFIVKLPSAERVAWMWCLIFAFWVPQLGSLFRSSR 152 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 5.4 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +1 Query: 19 ILQSSWFKPPCSL 57 +LQS W P C L Sbjct: 559 VLQSLWASPTCDL 571 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 20.6 bits (41), Expect = 7.1 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 Query: 324 PHSGKSRALPTQTYIPCSRSHQPLHVVS 407 P R+ P Q+ + S H+PL + + Sbjct: 224 PTKSSPRSSPVQSDVSLSPVHEPLLITT 251 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = -2 Query: 432 AETYFDVAGRRHVGVDATVST 370 A +FD++ +G+ AT++T Sbjct: 325 AANFFDISRSTFLGILATITT 345 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 216 HRVAGPRNPPNSS 254 H+ GPR+PP+ S Sbjct: 352 HQNFGPRHPPDCS 364 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 20.6 bits (41), Expect = 7.1 Identities = 7/21 (33%), Positives = 10/21 (47%) Frame = +3 Query: 384 HQPLHVVSLPHRSMSQRTRRC 446 HQ H ++ H +S RC Sbjct: 314 HQQHHQQNMSHEELSAMVNRC 334 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,448 Number of Sequences: 336 Number of extensions: 2220 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10301074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -