BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00985 (704 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 30 0.28 SPBC3D6.06c |||ribose-phosphate pyrophosphokinase |Schizosacchar... 27 2.6 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 30.3 bits (65), Expect = 0.28 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -1 Query: 563 ICETYWFNDVILTKPNKYIYPLRFILMIILENLRSCNI 450 IC Y + D++L+K +KY+ L I L N + I Sbjct: 273 ICRNYSYMDILLSKKSKYVKKLEKYWSIYLSNCKKLGI 310 >SPBC3D6.06c |||ribose-phosphate pyrophosphokinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 341 Score = 27.1 bits (57), Expect = 2.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 447 LDIARSKIFQYDHQYES*RIYIFIRLCENYIIKPISFTYN 566 LDI R ++ ++ + S RI +R C+ YI+ P S N Sbjct: 25 LDIGRVELSKFSNGETSVRIKQSVRGCDVYIVSPASGQVN 64 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,885,142 Number of Sequences: 5004 Number of extensions: 58939 Number of successful extensions: 141 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 141 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 327172622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -