BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00985 (704 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK124805-1|BAC85954.1| 189|Homo sapiens protein ( Homo sapiens ... 38 0.035 AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens ... 31 5.3 AK126884-1|BAC86735.1| 175|Homo sapiens protein ( Homo sapiens ... 30 9.3 >AK124805-1|BAC85954.1| 189|Homo sapiens protein ( Homo sapiens cDNA FLJ42815 fis, clone BRCAN2014143. ). Length = 189 Score = 37.9 bits (84), Expect = 0.035 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +2 Query: 134 VCLNIXLFVCVYTCPDTINDQYTNLQMFARGRLPIYIRTHLMCC 265 +C+++ ++VCV+ C YT++ + R R +Y+RTH C Sbjct: 80 MCMHVCVYVCVHACMCVCTCAYTHVFVCVRVRTCVYMRTHTHIC 123 >AK124803-1|BAC85953.1| 180|Homo sapiens protein ( Homo sapiens cDNA FLJ42813 fis, clone BRCAN2012355. ). Length = 180 Score = 30.7 bits (66), Expect = 5.3 Identities = 15/57 (26%), Positives = 27/57 (47%) Frame = +2 Query: 113 YISMKRTVCLNIXLFVCVYTCPDTINDQYTNLQMFARGRLPIYIRTHLMCCCVPNIF 283 Y+ VC++I + V +Y C T ++ M + +YI TH+ C N++ Sbjct: 60 YVYTYTYVCVHIHICVHIYLCMYTHTYMCAHIHMCVYTYIYVYIYTHIHICVHINMY 116 >AK126884-1|BAC86735.1| 175|Homo sapiens protein ( Homo sapiens cDNA FLJ44936 fis, clone BRAMY3018121. ). Length = 175 Score = 29.9 bits (64), Expect = 9.3 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 6/49 (12%) Frame = +2 Query: 161 CVYTCPDTINDQ------YTNLQMFARGRLPIYIRTHLMCCCVPNIFKF 289 C++TC DT YT++ M + IY + H+ C NI+ + Sbjct: 20 CIHTCTDTHTHMHTHTLTYTHIHMHTHTQTHIYTQAHIHSCTQINIYTY 68 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,934,807 Number of Sequences: 237096 Number of extensions: 1812043 Number of successful extensions: 2754 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2743 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -