BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00983 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 25 0.73 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 25 0.73 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.73 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 25 0.73 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 25 0.73 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 25 0.73 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 25 0.73 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 25 0.73 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.97 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 24 1.3 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 24 1.3 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 24 1.3 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 24 1.3 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.3 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 24 1.3 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 24 1.3 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 24 1.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.3 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 24 1.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 24 1.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 24 1.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 24 1.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 24 1.3 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 24 1.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 24 1.3 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 6.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.8 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 21 9.0 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 9.0 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 25.0 bits (52), Expect = 0.73 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R +WL+ +E Sbjct: 28 RSRTKEERLQHRREVWLIQQERE 50 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.6 bits (51), Expect = 0.97 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQEPTLNVYQRR 149 RSRT+ ER R WLV +E +R+ Sbjct: 28 RSRTKEERLQYRREAWLVQQEREQEYEKLKRK 59 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 244 RSRTERERADDGRHLWLVGDGQE 176 RSRT+ ER R WL+ +E Sbjct: 28 RSRTKEERLQHRREAWLIQQERE 50 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 516 PENYSIWYAEYKY 554 P NYS WY + Y Sbjct: 202 PANYSGWYLNHDY 214 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 516 PENYSIWYAEYKY 554 P NYS WY + Y Sbjct: 202 PANYSGWYLNHDY 214 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 322 HTSYLFCPPSCSVHQLTP 269 HT+ FC P C + + P Sbjct: 39 HTTNAFCLPFCGPNVINP 56 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 322 HTSYLFCPPSCSVHQLTP 269 HT+ FC P C + + P Sbjct: 38 HTTNAFCLPFCGPNVINP 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,704 Number of Sequences: 438 Number of extensions: 4321 Number of successful extensions: 32 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -