BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00978 (416 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 22 2.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 22 2.8 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 3.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 4.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 20 8.4 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 22.2 bits (45), Expect = 2.1 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -3 Query: 168 GLKVTILCALLIHMSCHVMV*RLV*QIMLRHIQLVCY*HEDC 43 G K IL +L ++C VMV + + IQ+V Y + +C Sbjct: 182 GNKPVILTVVLPLLACGVMVVTHITMAHFKIIQVVPYCYINC 223 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.8 bits (44), Expect = 2.8 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 40 EAVFVLIADQLNMPQHNLSDQPSHHNVATHVNK 138 E + +L ++ LNM Q + SH ++ VN+ Sbjct: 301 EQMNLLHSNDLNMHQQHHQQNMSHEELSAMVNR 333 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 3.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 256 NNEAFTSIIISFPFTTLLEFYLVPL 330 N++AF S+ P + + E Y P+ Sbjct: 303 NDDAFNSVATPTPTSVMTELYPSPV 327 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 4.8 Identities = 9/33 (27%), Positives = 14/33 (42%) Frame = +1 Query: 61 ADQLNMPQHNLSDQPSHHNVATHVNKQRTQYGH 159 A Q N ++Q HH+ H++ Q H Sbjct: 307 AQQQNNNNAATNNQNHHHHAGHHIHAQHHVVNH 339 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.2 bits (40), Expect = 8.4 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 295 FTTLLEFYLVPLEVLFVLHNFNESHILNLSYKV 393 F + +LVP LH E H+ + YKV Sbjct: 1221 FYVCVNGHLVPQNCAPGLHYNPEEHMCDWKYKV 1253 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,482 Number of Sequences: 336 Number of extensions: 2319 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9174063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -