BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00978 (416 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 0.79 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 23 1.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 5.6 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 20 9.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 20 9.7 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 0.79 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 208 DAQSDDI*VCYICSCPNNEAF 270 D+ + + CY+C PN+E F Sbjct: 1059 DSDRERLYDCYVCYSPNDEDF 1079 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.6 bits (46), Expect = 1.8 Identities = 10/40 (25%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -3 Query: 357 KVVKNKQYFKRYQVKFKKRREGKTD-YYARKRLVVRTRTN 241 K KN+ +++Y+ K+R KT+ +++R ++ + +N Sbjct: 286 KSYKNENSYRKYRETSKERSRDKTERERSKERKIISSLSN 325 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +1 Query: 109 HHNVATHVNKQRTQ 150 HHNV H RTQ Sbjct: 1680 HHNVNKHCTIHRTQ 1693 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.7 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 238 YICSCPNNEAFTSIIISFPFTTLLEFYLVPLE 333 YI PN SI IS + + L PL+ Sbjct: 139 YIRIFPNGSVLYSIRISLTLSCPMNLKLYPLD 170 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.2 bits (40), Expect = 9.7 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +1 Query: 238 YICSCPNNEAFTSIIISFPFTTLLEFYLVPLE 333 YI PN SI IS + + L PL+ Sbjct: 139 YIRIFPNGSVLYSIRISLTLSCPMNLKLYPLD 170 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,522 Number of Sequences: 438 Number of extensions: 2661 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10626762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -