BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00977 (670 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 1.6 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 2.9 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 2.9 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 6.6 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 6.6 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 23 6.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 6.6 AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.7 AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 pr... 23 8.7 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 23 8.7 AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. 23 8.7 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 8.7 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +2 Query: 410 CLDNGLGLCSLDACRRSSTPKKFELIQGRECAPD 511 C G +C + C R P ELI GR C D Sbjct: 560 CSGRGQCVCGVCVCERRPNPD--ELIDGRYCECD 591 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 24.6 bits (51), Expect = 2.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 145 VPGLHFRAPLSQCRAKTIKQIAIKHLISL 59 V +HFR+P + A ++ I I HL L Sbjct: 323 VLNIHFRSPQTHTMAPWVRTIFINHLPKL 351 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 2.9 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -1 Query: 631 IVFGAHSFFGSIMCSVQVRHYKCRIHR 551 ++F +++FFG +M S Q +Y+ +H+ Sbjct: 88 LMFESNAFFGMLMFSFQRDNYERLVHQ 114 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 260 RFRQAFHFRLHFLDGRRVICC 198 RFR F LH + G + +CC Sbjct: 573 RFRSGFILVLHGVPGLQQLCC 593 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.4 bits (48), Expect = 6.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 401 CYNPSGRRCLADNAQVQ 351 CY+PS R+C + Q + Sbjct: 1447 CYSPSDRQCAEEREQAE 1463 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.4 bits (48), Expect = 6.6 Identities = 11/44 (25%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 425 LGLCSLDA-CRRSSTPKKFELIQGRECAPDRRGRTSVTVVGAMP 553 +G+C+ C P + GR+ RG+ V+ +MP Sbjct: 126 IGMCAFGIECNSMRNPDAEFRVMGRKIFSKPRGKVKSLVINSMP 169 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +2 Query: 266 ESNCHFCRCSDSGV--AECLRQDSCDQIIFTEPVRC 367 E CH C C SG ++C + C E RC Sbjct: 981 EDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGRRC 1016 >AY825548-1|AAV70159.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 452 YRHPRSIGPDRYLSRRKCYNPS 387 Y HP + PD +L R P+ Sbjct: 151 YPHPETFNPDNFLPERTQNRPT 172 >AY825547-1|AAV70158.1| 173|Anopheles gambiae cytochrome P450 protein. Length = 173 Score = 23.0 bits (47), Expect = 8.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -3 Query: 452 YRHPRSIGPDRYLSRRKCYNPS 387 Y HP + PD +L R P+ Sbjct: 151 YPHPETFNPDNFLPERTQNRPT 172 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 23.0 bits (47), Expect = 8.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -2 Query: 270 LSHSVPPGIPLPTAFLGRQTR 208 L ++PPG P P A + R++R Sbjct: 89 LPDTLPPGFPYPGAGVHRRSR 109 >AF457551-1|AAL68781.1| 406|Anopheles gambiae calreticulin protein. Length = 406 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 147 EGPCAAEQESKDKPSQITTDDA 212 EG AAE+ +KD + DDA Sbjct: 366 EGEAAAEEAAKDDEDEDDEDDA 387 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.0 bits (47), Expect = 8.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 139 LAQKAHVQQSKNQKTNRVR*QQMTRLPS 222 L Q+AH QQ + Q+ R R ++ +PS Sbjct: 293 LRQQAHQQQQRQQQKVRPRPDKIEVVPS 320 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 808,218 Number of Sequences: 2352 Number of extensions: 18417 Number of successful extensions: 108 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66904800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -