BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00977 (670 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 1.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 24 1.5 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 6.1 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/46 (26%), Positives = 18/46 (39%) Frame = -1 Query: 637 FHIVFGAHSFFGSIMCSVQVRHYKCRIHRHCTYNCYTGSTTTIRSA 500 FH++ S+ S Q+ Y+CR T S +R A Sbjct: 185 FHLLPTGELLVHSLEFSDQIHGYRCRTMHRLTRQVVVSSVANVRIA 230 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.8 bits (49), Expect = 1.5 Identities = 12/46 (26%), Positives = 18/46 (39%) Frame = -1 Query: 637 FHIVFGAHSFFGSIMCSVQVRHYKCRIHRHCTYNCYTGSTTTIRSA 500 FH++ S+ S Q+ Y+CR T S +R A Sbjct: 185 FHLLPTGELLVHSLEFSDQIHGYRCRTMHRLTRQVVVSSVANVRIA 230 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +3 Query: 246 CLAEPSGRATATSAG 290 C AEPS A +T++G Sbjct: 351 CAAEPSSDAVSTTSG 365 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -2 Query: 585 CRFVTTNAVSIGIAPTTVTLVRPRRSGAHSLPWIS 481 C +TT A+ +G+ + P + + PW S Sbjct: 494 CWTITTPAICVGVFTFNIIKFVPVKYLTYEYPWWS 528 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.1 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = -2 Query: 585 CRFVTTNAVSIGIAPTTVTLVRPRRSGAHSLPWIS 481 C +TT A+ +G+ + P + + PW S Sbjct: 547 CWTITTPAICVGVFTFNIIKFVPVKYLTYEYPWWS 581 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,737 Number of Sequences: 438 Number of extensions: 4211 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -