BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00976 (688 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1709.13c |||lysine methyltransferase |Schizosaccharomyces po... 28 1.1 SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces p... 27 1.9 SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomy... 27 3.4 SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchang... 26 4.4 >SPBC1709.13c |||lysine methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 28.3 bits (60), Expect = 1.1 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 4/79 (5%) Frame = -1 Query: 412 IFYVLVVLSRILQL*NKNLGEAFEILILIYIAFY--QHCLYN--THACQSLYSNSTLHYH 245 I YV + LQ K L + LIL I+ + QH L+ +HA +SLY ++ Sbjct: 391 ITYVKNYMEESLQKTYKPLPNLLQYLILNSISIFLLQHPLFAPLSHAIESLYGSTDAEAL 450 Query: 244 SWSEELSLVMS*FNIVCLS 188 ++E ++M + CLS Sbjct: 451 VATDEQDILMILICVYCLS 469 >SPAC22F8.08 |||COPII vesicle coat protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 926 Score = 27.5 bits (58), Expect = 1.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 86 SDDGCNSPRECFEPGYPSAGQVEASGP 166 S N P + F+P YP AGQ++ + P Sbjct: 16 SSGNSNIPPQGFQPVYPVAGQLDNTAP 42 >SPAC6G9.12 |cfr1||Chs five related protein Cfr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 620 Score = 26.6 bits (56), Expect = 3.4 Identities = 15/61 (24%), Positives = 25/61 (40%) Frame = +3 Query: 51 NEDDDNPIPGTSQTMGATPRGNVLNRVTHQQDKWKRQVREQRRNIYDRHTMLN*LMTKLN 230 N DDD P P ++ +G + +V+ + K + N D+ LN K + Sbjct: 531 NSDDDKPSPAAAEDIGTNGAIEEIPQVSEVLEPEKAHTTNLQLNALDKEEDLNITTVKQS 590 Query: 231 S 233 S Sbjct: 591 S 591 >SPAC19A8.01c |sec73|sec7c, SPAC23H3.01|guanyl-nucleotide exchange factor Sec73 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1082 Score = 26.2 bits (55), Expect = 4.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 42 EHTNEDDDNPIPGTSQTMGATPRGNVLNRVTHQQDK 149 E +N+ DD P TS + P N +NR TH +K Sbjct: 904 ESSNDIDDRP-SSTSPSTLKNPSINSINRQTHDVEK 938 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,798,334 Number of Sequences: 5004 Number of extensions: 55348 Number of successful extensions: 124 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -