BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00975 (725 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 28 0.34 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 26 1.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 7.3 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 27.9 bits (59), Expect = 0.34 Identities = 20/68 (29%), Positives = 31/68 (45%) Frame = +2 Query: 143 QQARHSSSIVRSRCQTR*IKCDTGGSHVTTRSSKTTSPVLKVGESRHVRLDIEFPDAPVT 322 Q A+H S+ + T T + TT ++ TT+ VGES + L+I+ PV+ Sbjct: 132 QVAKHDLSMGATTSTTSTTATTTTTTTTTTTTTTTTTTPNPVGESDQI-LEIQASTTPVS 190 Query: 323 FTLVQGSG 346 T G Sbjct: 191 ATTANSLG 198 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 61 SFSMVSPFHHHISQRHGIQR 120 S S SPFHHH Q+ QR Sbjct: 19 SSSQRSPFHHHHQQQQNHQR 38 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 7.3 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = +3 Query: 552 CQEMNKPPGDPFWASRTVAILGIIISKLCRRXCDHPASYNYLVW*FSIG*H 704 C + + P +P W++RT+ L K RR + +++N+ ++ ++ H Sbjct: 323 CTPIFRSPPNPPWSNRTLRNLKKDRMKYLRRYRLNRSAFNFRLFKYAASAH 373 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 721,258 Number of Sequences: 2352 Number of extensions: 13708 Number of successful extensions: 33 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -