BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00974 (420 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 0.80 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 1.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 7.5 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 20 9.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 20 9.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 20 9.9 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 23.8 bits (49), Expect = 0.80 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 132 LGSFISFHRWTSLLVPGKFSNLY 64 + SFI+ W L VPGK + +Y Sbjct: 188 ISSFITNGEWDLLGVPGKRNEIY 210 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.6 bits (46), Expect = 1.8 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = +3 Query: 90 LARTSTCGTI*TNPVSSTVQRSPCPRTVATTSHPRTVWR 206 ++RTST G TN ++ S TV T +W+ Sbjct: 720 VSRTSTAGQFPTNVATTVTSMSIDQSTVIQTGANVNLWQ 758 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 7.5 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 224 EHRHVHNEYGRGTCAP 271 E+ +VH+EY C P Sbjct: 475 EYEYVHDEYTCMDCGP 490 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 197 GLEGLADYWEHRHVHNEYGRGTCAPP 274 G E AD+W+ + NE APP Sbjct: 334 GEEEKADWWKDIMLLNEKTLAVPAPP 359 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 197 GLEGLADYWEHRHVHNEYGRGTCAPP 274 G E AD+W+ + NE APP Sbjct: 334 GEEEKADWWKDIMLLNEKTLAVPAPP 359 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 9.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 197 GLEGLADYWEHRHVHNEYGRGTCAPP 274 G E AD+W+ + NE APP Sbjct: 334 GEEEKADWWKDIMLLNEKTLAVPAPP 359 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,667 Number of Sequences: 438 Number of extensions: 2560 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -