BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00973 (685 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 25 0.51 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 25 0.51 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 25 0.51 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 3.6 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.4 bits (53), Expect = 0.51 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +1 Query: 127 GMATSLDATEEMADYETALDKAGYGRFSRSALGACVCAFFAS 252 G+ T L T M+ AL K Y + LG C FAS Sbjct: 256 GVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFAS 297 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.4 bits (53), Expect = 0.51 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +1 Query: 127 GMATSLDATEEMADYETALDKAGYGRFSRSALGACVCAFFAS 252 G+ T L T M+ AL K Y + LG C FAS Sbjct: 256 GVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFAS 297 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 25.4 bits (53), Expect = 0.51 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +1 Query: 127 GMATSLDATEEMADYETALDKAGYGRFSRSALGACVCAFFAS 252 G+ T L T M+ AL K Y + LG C FAS Sbjct: 195 GVTTVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFAS 236 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 407 PAEDIAHYTPEECTGDTTAHKSHVDQ 330 P D + E+C+G +AHK +D+ Sbjct: 111 PYPDWSFAKYEDCSGIVSAHKIAIDE 136 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,840 Number of Sequences: 438 Number of extensions: 3807 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -