BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00971 (743 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.4 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 3.4 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 22 6.0 AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochr... 22 6.0 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 21 7.9 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 21 7.9 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/49 (22%), Positives = 18/49 (36%) Frame = +2 Query: 461 LTYMEHKXXXXXXXXXXXXPVKAVSWVSFQGDQATFVSGSHDQTAILWV 607 LT H PV+ + +SF G++ FV + W+ Sbjct: 360 LTIQGHDLTLIATDGEPVHPVRVNTIISFSGERYDFVINADQTPGAYWI 408 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/49 (22%), Positives = 18/49 (36%) Frame = +2 Query: 461 LTYMEHKXXXXXXXXXXXXPVKAVSWVSFQGDQATFVSGSHDQTAILWV 607 LT H PV+ + +SF G++ FV + W+ Sbjct: 360 LTIQGHDLTLIATDGEPVHPVRVNTIISFSGERYDFVINADQTPGAYWI 408 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.8 bits (44), Expect = 6.0 Identities = 5/13 (38%), Positives = 11/13 (84%) Frame = +2 Query: 596 ILWVWNVPRNSVD 634 ++ +WN+PR ++D Sbjct: 436 LMEMWNIPRENID 448 >AF265300-1|AAG17643.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenase protein. Length = 126 Score = 21.8 bits (44), Expect = 6.0 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +3 Query: 309 EKGVSTEDTLEVEYLER 359 ++ ++ DTL+++YLER Sbjct: 34 DRPITFNDTLQMKYLER 50 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.4 bits (43), Expect = 7.9 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +2 Query: 302 LTRKRGIDRGHA*GRILGKVPCTNSTGLFNARRL 403 L R+ G++R +LGK+P T S L +A+ L Sbjct: 339 LFRETGLERLDVSHNLLGKLPLT-SLSLASAQTL 371 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/10 (80%), Positives = 10/10 (100%) Frame = +3 Query: 330 DTLEVEYLER 359 DTLE++YLER Sbjct: 41 DTLEMKYLER 50 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,217 Number of Sequences: 336 Number of extensions: 4001 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19819879 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -