BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00969 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) 31 1.3 SB_39106| Best HMM Match : Prion (HMM E-Value=1.2) 30 2.3 >SB_47142| Best HMM Match : Tubulin (HMM E-Value=5.32493e-44) Length = 474 Score = 30.7 bits (66), Expect = 1.3 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 292 VKWYPKFQTLHVVCVVRDHKNYQRTFFVQNNNKTH 188 V W P + + C +R NY+++ + +N++TH Sbjct: 389 VDWMPSYDLGSITCHLRPFNNYEKSVTLLSNSQTH 423 >SB_39106| Best HMM Match : Prion (HMM E-Value=1.2) Length = 523 Score = 29.9 bits (64), Expect = 2.3 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -3 Query: 286 WYPKFQTLHVVCVVRDHKNYQRTFFVQNNNKTHENYPHIKDYNNNEV 146 W + + L C + K+ Q V N + +E++PHI D NEV Sbjct: 222 WRNEHKDLLEGCYSYEEKHKQVESIVNKNREKYEHHPHILDKAANEV 268 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,005,000 Number of Sequences: 59808 Number of extensions: 411686 Number of successful extensions: 870 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 863 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -