BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00969 (765 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70757-4|CAA94800.1| 1208|Caenorhabditis elegans Hypothetical pr... 29 3.6 Z81116-3|CAB03303.1| 346|Caenorhabditis elegans Hypothetical pr... 28 6.3 >Z70757-4|CAA94800.1| 1208|Caenorhabditis elegans Hypothetical protein ZK287.4 protein. Length = 1208 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +1 Query: 175 EGNS-HAFYCCFVQKRFAGNFCDLSP 249 EG S H+FYCC ++FA N C L P Sbjct: 28 EGQSEHSFYCCPSSRKFA-NRCHLPP 52 >Z81116-3|CAB03303.1| 346|Caenorhabditis elegans Hypothetical protein T06C12.3 protein. Length = 346 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = -3 Query: 337 ISLTWLSGRVPSLSDVKWYPKFQTLHVVCVVRDHKNYQRTFFVQNNNKTHENY 179 + + W +G + +L + YP F ++ + +V +++NY R+ NK+ + Sbjct: 276 MEINWKTGWLYTLIGI--YPIFDSIAFILIVSEYRNYVRSKLFCKTNKSPREF 326 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,161,991 Number of Sequences: 27780 Number of extensions: 330700 Number of successful extensions: 658 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 658 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1830096852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -