BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00963 (711 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0564 + 22218955-22219060,22219184-22219293,22222363-22223682 29 3.6 >06_03_0564 + 22218955-22219060,22219184-22219293,22222363-22223682 Length = 511 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/69 (27%), Positives = 29/69 (42%) Frame = +2 Query: 191 VSSQCTVSSLTCVLTE*LIEMSHESPYREHCSF*MRVKIECEPFVFLICEINYLNVKCLI 370 +S SS C T L+ M S EH S +C +L C + L + CL+ Sbjct: 133 ISMFLAFSSFVCGCTFMLLRMQRLSAREEHISGFHHAISKC--LFYLCCVLPVLTILCLL 190 Query: 371 VFGEQKKYV 397 + +K Y+ Sbjct: 191 LVMPRKPYI 199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,700,758 Number of Sequences: 37544 Number of extensions: 288261 Number of successful extensions: 497 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 497 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -