BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00962 (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglu... 25 0.49 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 23 3.4 >EF592537-1|ABQ95983.1| 593|Tribolium castaneum beta-N-acetylglucosaminidase NAG2 protein. Length = 593 Score = 25.4 bits (53), Expect = 0.49 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 692 WLYYYAVLVNNRKQADGIYGDSC 624 WLY A+ V++RK GI+ C Sbjct: 12 WLYLTAIYVSSRKSDSGIWYWQC 34 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 697 PNGYIIMLY*LTIESRQMA--FMETVVSLSRVFFQNIESVNLYHISILSTNS 548 PN YI + E+ F+ + F++++ +LYHIS ++ +S Sbjct: 301 PNYYIAHFINIDPENHNKTEIFLNITGDKTNSVFEHVKLGSLYHISFMACSS 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,907 Number of Sequences: 336 Number of extensions: 3061 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -