BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00962 (747 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1D4.07c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.6 SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizos... 27 3.8 >SPAC1D4.07c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 27.9 bits (59), Expect = 1.6 Identities = 11/31 (35%), Positives = 23/31 (74%) Frame = +2 Query: 293 HYTNAFHDYISIVPMLQLNLVSKMSLVIFLK 385 +Y N++ D+IS++ M +++ + +S+ IFLK Sbjct: 38 YYKNSYSDFISVLQMYKVH-IRMVSIYIFLK 67 >SPAC144.15c |cog1||Golgi transport complex subunit Cog1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 701 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 590 FNILKENS*KANNCLHKCHLPAF 658 FNI KE N CL +C+L A+ Sbjct: 251 FNIFKEKEILRNICLDECYLKAY 273 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,658,877 Number of Sequences: 5004 Number of extensions: 50561 Number of successful extensions: 91 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -