BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00961 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 0.94 DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 24 1.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 3.8 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 549 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 647 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 549 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 647 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 549 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 647 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.2 bits (50), Expect = 0.94 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 549 SLMPYMFK*IGFYLA*LYVHIDRKNVISPINYL 647 S + YM+ +G L L + +DRK VI+ YL Sbjct: 699 SQVMYMYYLLGHRLMELPISVDRKAVIAENTYL 731 >DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 protein. Length = 377 Score = 23.8 bits (49), Expect = 1.2 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = -3 Query: 344 YDNQRFNLLKYLPKINKNINAILIFGTSQNDQNKYC 237 YDN++ +K KN+ + I+ +D +++C Sbjct: 326 YDNEQSVTIKTEYAKEKNLAGVFIWSIETDDMHEFC 361 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 128 HICYTNIMSISKECSL 175 H+CY+ I +SK L Sbjct: 927 HVCYSTIQEVSKSGEL 942 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,338 Number of Sequences: 336 Number of extensions: 2929 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -