BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00961 (652 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2... 26 4.1 SPBC17A3.06 |||phosphoprotein phosphatase|Schizosaccharomyces po... 25 7.2 SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schiz... 25 7.2 >SPBC800.13 |||histone H4 variant|Schizosaccharomyces pombe|chr 2|||Manual Length = 479 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 551 RRQKESITKKSLETMSTNYLSKEI 480 +RQ++ KKSL ++ YLS+EI Sbjct: 448 KRQRKISEKKSLSSLMQQYLSREI 471 >SPBC17A3.06 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 330 Score = 25.4 bits (53), Expect = 7.2 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = -3 Query: 449 LLKYFDKFAVEFTLVLINLTFNVKLTESSNN**Q*YDNQRFNLLKYLPKINKNI 288 L+ DK +++TL +++ N+ + E + Q D+ N+L+Y K NK I Sbjct: 65 LVSTSDK-GIDYTLSAMSINPNLSVPEQQHLWLQIEDSSSQNILQYFEKSNKFI 117 >SPCC553.07c |mug40||DinB translesion DNA repair polymerase|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.4 bits (53), Expect = 7.2 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -3 Query: 584 KTNLLKHVWHKRRQKESITKKSLETMSTNYLSKEICFAMRVR 459 +++LLK RQ +T + L +T +SK C AM+++ Sbjct: 442 ESDLLKPALQLLRQSYPMTIRLLGVRATKLVSKSRCLAMQLK 483 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,435,079 Number of Sequences: 5004 Number of extensions: 46559 Number of successful extensions: 96 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -