BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00958 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 25 0.48 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 25 0.48 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 25 0.48 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 4.5 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.4 bits (53), Expect = 0.48 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 431 SEGNGTNISALNRAKYSRSQLPPWDSVPE 517 SEG+ AL RA YSR P +D E Sbjct: 392 SEGDLEKCKALTRAAYSRDVRPKYDCTLE 420 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.4 bits (53), Expect = 0.48 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 431 SEGNGTNISALNRAKYSRSQLPPWDSVPE 517 SEG+ AL RA YSR P +D E Sbjct: 392 SEGDLEKCKALTRAAYSRDVRPKYDCTLE 420 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 25.4 bits (53), Expect = 0.48 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 431 SEGNGTNISALNRAKYSRSQLPPWDSVPE 517 SEG+ AL RA YSR P +D E Sbjct: 392 SEGDLEKCKALTRAAYSRDVRPKYDCTLE 420 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 583 HHIEHPLQLGASTPPPLV 636 HH + P L ASTP P+V Sbjct: 1100 HHRDLPCVLRASTPAPVV 1117 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 4.5 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 6/69 (8%) Frame = +1 Query: 448 EYIGFKQSEVLQIAVTTMGQCSGS--GALT----STPRKAQRCISKGVASEHHIEHPLQL 609 E GF+ VL+ +T+ G SGS G+ T S ++ +R + G H E L Sbjct: 1052 EVEGFETKLVLEDGITSSGSDSGSSNGSWTAGTVSQQKQKRRMVKYGKLVMIH-EENAPL 1110 Query: 610 GASTPPPLV 636 + PP +V Sbjct: 1111 PPALPPQVV 1119 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,500 Number of Sequences: 438 Number of extensions: 3780 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -