BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00957 (583 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 26 0.20 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 26 0.27 EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetyla... 22 3.3 EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetyla... 22 3.3 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.2 bits (55), Expect = 0.20 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 441 GGAAVVTMLETLELISQGGWRI*LWMSMGSSNHLIPG 551 G A ++ E +EL +GGW++ +W + H+ G Sbjct: 292 GEAGMLGYNEIVELQKEGGWKV-VWDDTQKNTHMYKG 327 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 25.8 bits (54), Expect = 0.27 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 234 GRCIVSSPPLPPTLLRCLKGKSFDCNRYFTFAIIDKKVTGGRI 362 G C S+ P + R L+GK +C+ AI++ VT I Sbjct: 144 GICDRSTAPSVSAISRLLRGKGGECDEITIQAILEFSVTNPTI 186 >EU019713-1|ABU25225.1| 528|Tribolium castaneum chitin deacetylase 2B protein. Length = 528 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 453 RLPHPSNRNALLLHGRNRRVWWYPLAQTHKR 361 R+PH N NA R+ VW + + +R Sbjct: 336 RMPHKCNGNAHNCPSRSHPVWEIVMNELDRR 366 >EU019712-1|ABU25224.1| 535|Tribolium castaneum chitin deacetylase 2A protein. Length = 535 Score = 22.2 bits (45), Expect = 3.3 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -2 Query: 453 RLPHPSNRNALLLHGRNRRVWWYPLAQTHKR 361 R+PH N NA R+ VW + + +R Sbjct: 343 RMPHKCNGNAHNCPSRSHPVWEIVMNELDRR 373 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,818 Number of Sequences: 336 Number of extensions: 2465 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14517299 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -