BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00957 (583 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 23 7.2 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 7.2 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 7.2 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 23.0 bits (47), Expect = 7.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -3 Query: 422 YCFTAEIGGCGGTHSRRLTRDPTTSNLFINNRESKIPITIE 300 Y AEI G G S T PTT+ N R +K + ++ Sbjct: 471 YKLEAEIRGYAGVQSHHETFLPTTTEEERNARYTKWKMAVQ 511 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.0 bits (47), Expect = 7.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 61 NKFIFEWRTAPMPP 20 NK+IFEW+ M P Sbjct: 209 NKYIFEWQKTQMFP 222 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 23.0 bits (47), Expect = 7.2 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = -3 Query: 563 SSQPTWY*VVTGTHRHPQLNAPPT 492 SS+P G+HR P L+ PPT Sbjct: 2 SSRPPGVNRPPGSHRPPGLSNPPT 25 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 565,074 Number of Sequences: 2352 Number of extensions: 9848 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -