BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00956 (733 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces... 26 6.4 SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |S... 26 6.4 >SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces pombe|chr 1|||Manual Length = 609 Score = 25.8 bits (54), Expect = 6.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +2 Query: 320 DPVITFPKFEQKYDTTI 370 +P I+FP F+ Y+TT+ Sbjct: 390 NPFISFPSFQTSYETTV 406 >SPAC589.12 ||SPAC688.01|glycosylceramide biosynthesis protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 971 Score = 25.8 bits (54), Expect = 6.4 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 585 NIIKNSNIFSSHIFKLFS*VYF*SEISCVFRFASHL 692 NI K+SN+ S LFS +YF SE+ F F S L Sbjct: 261 NIKKDSNVKCSKKQILFSLLYFSSEVYLSFVFWSVL 296 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,781,997 Number of Sequences: 5004 Number of extensions: 53343 Number of successful extensions: 97 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -