BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00955 (565 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.01 |sif2|SPCC5E4.09|Sad1 interacting factor 2|Schizosac... 27 1.4 SPBC15C4.02 |||ABC1 kinase family protein|Schizosaccharomyces po... 26 4.4 >SPCC16C4.01 |sif2|SPCC5E4.09|Sad1 interacting factor 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 446 Score = 27.5 bits (58), Expect = 1.4 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = -3 Query: 131 PQPEPRMRICKGYPSDNTASAA-NKKIEVMLNGLTALKEQYSH 6 PQ EP + Y N A N+++EV+ + L+ LKEQ +H Sbjct: 307 PQLEPIYTAARSYLEINQRVALLNQRVEVIGDLLSMLKEQITH 349 >SPBC15C4.02 |||ABC1 kinase family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 594 Score = 25.8 bits (54), Expect = 4.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -2 Query: 81 YCVRC*QKNRSDAKWSNRS 25 YC+RC ++ D+ W++RS Sbjct: 539 YCLRCVYDDKMDSLWNSRS 557 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,045,500 Number of Sequences: 5004 Number of extensions: 35999 Number of successful extensions: 57 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 238029836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -