BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00955 (565 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26492| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 >SB_26492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 29.1 bits (62), Expect = 2.6 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +3 Query: 102 ADSHARLGLWYIPIGS*QPECGRRRQG*CWCERFSSECESGC 227 AD + +GLW+ +G + C E+F EC+ C Sbjct: 308 ADVYYNIGLWFKSLGDNGQAMVNFKNALCIYEKFGEECKQAC 349 >SB_13708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 137 NVPQPEPRMRICKGYPSDNTASAANKKIEVMLNGLT 30 N P EP + + G P DNT ++ KI V NG + Sbjct: 7 NRPVHEP-LAVLSGVPKDNTIPSSAPKISVSKNGFS 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,974,174 Number of Sequences: 59808 Number of extensions: 268028 Number of successful extensions: 410 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 409 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -