BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00954 (664 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 25 0.55 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 2.2 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 9.0 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.0 bits (52), Expect = 0.55 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 595 YVKSF*DLCHYLQAFCIRY 539 +V++F LC++ + FC RY Sbjct: 534 HVRAFLGLCNFYRKFCARY 552 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 23.0 bits (47), Expect = 2.2 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -2 Query: 555 HSASGTIGSYTPAMSNRIDKIPC 487 H + G GSY N D PC Sbjct: 171 HCSDGYSGSYCQTEINECDSAPC 193 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 231 CNNFIQYIITYCHLLWVVVSCSLWCFKSKL 142 C NF IT + + V+ L+C+ S L Sbjct: 526 CKNFCFGFITKQLIFMIFVTYQLYCWSSFL 555 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,340 Number of Sequences: 336 Number of extensions: 3348 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17177325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -