BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00953 (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g66780.1 68418.m08418 expressed protein 29 2.4 At3g25560.2 68416.m03179 protein kinase family protein contains ... 29 2.4 At3g25560.1 68416.m03178 protein kinase family protein contains ... 29 2.4 At2g46375.1 68415.m05772 expressed protein 29 2.4 At5g51540.1 68418.m06391 peptidase M3 family protein / thimet ol... 28 5.5 At2g41370.1 68415.m05106 ankyrin repeat family protein / BTB/POZ... 28 5.5 At3g57230.1 68416.m06371 MADS-box protein (AGL16) MADS-box trans... 27 7.3 At3g57130.1 68416.m06360 ankyrin repeat family protein / BTB/POZ... 27 9.6 >At5g66780.1 68418.m08418 expressed protein Length = 121 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +1 Query: 358 FGAILSGKAAAKRGESVHQMNLDWHKKYQEEHKEKSSAK 474 FG I G ++ +H+ + D+ K E KEK A+ Sbjct: 76 FGGIYGGNQTLQKENEIHENHPDYDKTQGSESKEKEKAR 114 >At3g25560.2 68416.m03179 protein kinase family protein contains Prosite:PS00108: Serine/Threonine protein kinases active-site signature and PS00107: Protein kinases ATP-binding region signature Length = 636 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +1 Query: 271 VSAEIIERSKSEARIKISNV-LMLLTALASFGAILSGKAAAKRGESVHQMNLDWHKKYQE 447 ++ E + +S + + ++LL + A+ GKAA +RG LDW KK Q+ Sbjct: 479 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAI-----LDWVKKLQQ 533 Query: 448 EHK 456 E K Sbjct: 534 EKK 536 >At3g25560.1 68416.m03178 protein kinase family protein contains Prosite:PS00108: Serine/Threonine protein kinases active-site signature and PS00107: Protein kinases ATP-binding region signature Length = 635 Score = 29.1 bits (62), Expect = 2.4 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +1 Query: 271 VSAEIIERSKSEARIKISNV-LMLLTALASFGAILSGKAAAKRGESVHQMNLDWHKKYQE 447 ++ E + +S + + ++LL + A+ GKAA +RG LDW KK Q+ Sbjct: 478 IAPEYLSTGQSSEKTDVFGFGILLLELITGLRALEFGKAANQRGAI-----LDWVKKLQQ 532 Query: 448 EHK 456 E K Sbjct: 533 EKK 535 >At2g46375.1 68415.m05772 expressed protein Length = 123 Score = 29.1 bits (62), Expect = 2.4 Identities = 22/81 (27%), Positives = 35/81 (43%) Frame = +1 Query: 232 DKKIQEQIEVPPFVSAEIIERSKSEARIKISNVLMLLTALASFGAILSGKAAAKRGESVH 411 D + + E+ FV IIER + L AL + A+ KRG +H Sbjct: 27 DSTLYDSYELVSFV--HIIERKLMPFSPLARQPGLTLRALMDKDSDHCSCASTKRGPCIH 84 Query: 412 QMNLDWHKKYQEEHKEKSSAK 474 + W+ K ++E KE+ + K Sbjct: 85 RRKYWWNGKKKDEMKERINKK 105 >At5g51540.1 68418.m06391 peptidase M3 family protein / thimet oligopeptidase family protein low similarity to SP|Q99797 Mitochondrial intermediate peptidase, mitochondrial precursor (EC 3.4.24.59) {Homo sapiens}; contains Pfam profile PF01432: Peptidase family M3 Length = 860 Score = 27.9 bits (59), Expect = 5.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 318 NFKCAYASYCFGKFWSNIVWESCC*E 395 N+ Y SY + K +++ +W+S C E Sbjct: 624 NYGAGYYSYLYAKCFASTIWQSICEE 649 >At2g41370.1 68415.m05106 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 491 Score = 27.9 bits (59), Expect = 5.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 135 HLHRQDPVQQVHHHH 179 H H QDP HHHH Sbjct: 473 HHHHQDPSTMYHHHH 487 >At3g57230.1 68416.m06371 MADS-box protein (AGL16) MADS-box transcription factor DEFH125 - Antirrhinum majus, PIR:T17029; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); contains Pfam domain PF01486: K-box region Length = 240 Score = 27.5 bits (58), Expect = 7.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 391 KRGESVHQMNLDWHKKYQEEHKE 459 + G VHQ NLD HKK H++ Sbjct: 154 REGNLVHQENLDLHKKVNLMHQQ 176 >At3g57130.1 68416.m06360 ankyrin repeat family protein / BTB/POZ domain-containing protein contains Pfam domain, PF00023: Ankyrin repeat and Pfam domain, PF00651: BTB/POZ domain Length = 467 Score = 27.1 bits (57), Expect = 9.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 123 GRCVHLHRQDPVQQVHHHH 179 G +H H DP HHHH Sbjct: 446 GMNLHHHHHDPSTMYHHHH 464 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,804,561 Number of Sequences: 28952 Number of extensions: 193570 Number of successful extensions: 459 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -