BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00952 (762 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 27 0.16 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 24 1.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.1 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 27.1 bits (57), Expect = 0.16 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -3 Query: 310 RAPRPSVYNSSLAGTSSSSRIRSQKVLARRLH 215 RAPRP +YN ++ + R + QKVL + LH Sbjct: 213 RAPRPWIYNETIYSLTPQGR-KEQKVL-KSLH 242 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 277 LAGTSSSSRIRSQKVLARRLHRRSQRT 197 LAGTSS S ++ ++ RR H R T Sbjct: 259 LAGTSSPSNRFTRHLIQRRTHTRHTTT 285 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 698 GHWLYECST*IIKCV 654 GHWL + + +I CV Sbjct: 784 GHWLQKATEHVIGCV 798 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 698 GHWLYECST*IIKCV 654 GHWL + + +I CV Sbjct: 784 GHWLQKATEHVIGCV 798 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 698 GHWLYECST*IIKCV 654 GHWL + + +I CV Sbjct: 784 GHWLQKATEHVIGCV 798 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 698 GHWLYECST*IIKCV 654 GHWL + + +I CV Sbjct: 784 GHWLQKATEHVIGCV 798 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,329 Number of Sequences: 336 Number of extensions: 2792 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20442493 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -