BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00952 (762 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 28 0.27 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 4.5 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 28.3 bits (60), Expect = 0.27 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +1 Query: 25 KLGEHFENDDDVIIAKIDATANELEHTKITSFPTI--KLYSKDNQV 156 +LG +FE + + ++ IDA++N+L ++ P LY DN + Sbjct: 583 ELGNYFEIESQLALSTIDASSNQLTEITGSAIPNSVELLYLNDNLI 628 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -3 Query: 334 TILWKSHKRAPRPSVYNSSLAGTSSSSRIRSQKVLARRLHRRSQR 200 T+ + + RPS+ +SS + + IR++ R+ HR+ Q+ Sbjct: 1062 TVRQREEQCGERPSMPSSSPRTSERRANIRARMARLRQRHRQHQQ 1106 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,277 Number of Sequences: 2352 Number of extensions: 12554 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -