BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00951 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_30126| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 >SB_58081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = +1 Query: 388 CITMSTSQLKINMNLSFCNKKATLPGLSKKKFFFSILQLSIC 513 C+ + +K N+ FC ++A + ++KK+F F +LS C Sbjct: 7 CLRYTPILMKTVKNVDFCAEEAAVKDVTKKRFDFCPHKLSEC 48 >SB_30126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 6.9 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -2 Query: 157 LALLVFFHAFSLPIRW*VRSRADLRNFASSKLGKSSVR 44 LAL + F FSL +R+ +R R LR + LGK R Sbjct: 50 LALTLVFDRFSLELRFRLRFRLRLRPSENQPLGKQVAR 87 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,145,499 Number of Sequences: 59808 Number of extensions: 382512 Number of successful extensions: 757 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 701 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -