BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00950 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1565.06c |spg1|sid3|GTPase Spg1|Schizosaccharomyces pombe|ch... 26 4.5 SPAC11D3.18c |||nicotinic acid plasma membrane transporter |Schi... 26 5.9 >SPAC1565.06c |spg1|sid3|GTPase Spg1|Schizosaccharomyces pombe|chr 1|||Manual Length = 198 Score = 26.2 bits (55), Expect = 4.5 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 373 RKDQDELIKLKSSYRKDQENGLGFDSTTSLLNI 275 R+DQ+E+ K Y K + L F ST+ +N+ Sbjct: 132 REDQEEITKQARRYAKAMKASLVFCSTSHSINV 164 >SPAC11D3.18c |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 498 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/41 (26%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = +1 Query: 499 QELSSGYNGTHRQEWI----AQNSPRVHLTAHRKNCVDMII 609 +++++ Y+G EW A P+V+++A + C DM++ Sbjct: 263 RDINARYHGEQHFEWSEVRKAFKDPKVYVSATSQFCADMVL 303 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,819,498 Number of Sequences: 5004 Number of extensions: 59379 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -