BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00948 (770 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo... 27 2.2 SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomy... 26 6.9 >SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 1|||Manual Length = 1616 Score = 27.5 bits (58), Expect = 2.2 Identities = 15/51 (29%), Positives = 29/51 (56%) Frame = -3 Query: 699 DLLILNCLSISTKDLFPISLRINQIFTNKFKKYCYNYIDNPTNLYLFILRS 547 DLL + S+++ FP++LRI++I F+ Y + + ++ FI+ S Sbjct: 245 DLLPIITASLASMSDFPVALRISRILNIIFQHYVTSLTLDIEVIFSFIISS 295 >SPAC1142.01 ||SPAC17G6.18|DUF654 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 667 Score = 25.8 bits (54), Expect = 6.9 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 639 RINQIFTNKFKKYCYNYIDNPTNLYLFILRSFPFHV 532 R Q F+ Y Y +P NL L +LRS PFH+ Sbjct: 262 RAYQEVQETFEYYVQTY--DPNNL-LMLLRSHPFHI 294 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,923,526 Number of Sequences: 5004 Number of extensions: 60360 Number of successful extensions: 122 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 371330890 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -