BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00948 (770 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 2.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 3.1 AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 22 5.5 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 9.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 9.6 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/27 (29%), Positives = 17/27 (62%) Frame = -2 Query: 565 PIYT*VVSISRILIPIDSFSLLFVPKP 485 P+Y +++I +I +P+ + F P+P Sbjct: 333 PLYYNIINIEQIPVPVPIYCGNFPPRP 359 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/25 (28%), Positives = 20/25 (80%) Frame = +2 Query: 629 WFIRSEIGNKSLVEIDKQFNISKSI 703 W++ +EIG++ L ++ +++N+ ++I Sbjct: 298 WYMSTEIGSRDLCDV-QRYNLLETI 321 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.2 bits (45), Expect = 5.5 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = +1 Query: 355 IYKRYLVFEPAYILKVSLSCYWF 423 I+ L+ E + +++ + SC+W+ Sbjct: 175 IFGNRLIEESSSVMEAAYSCHWY 197 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -3 Query: 603 YCYNYIDNPTNLYLFILRSFPFHVFSSQLTPF 508 YC N+ P ++ I P LTPF Sbjct: 123 YCGNFPPRPMGPWISIQEQIPRFRHIGPLTPF 154 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/32 (31%), Positives = 13/32 (40%) Frame = -3 Query: 603 YCYNYIDNPTNLYLFILRSFPFHVFSSQLTPF 508 YC N+ P ++ I P LTPF Sbjct: 364 YCGNFPPRPMGPWISIQEQIPRFRHIGPLTPF 395 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,491 Number of Sequences: 438 Number of extensions: 4532 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -