BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00943 (758 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 2.4 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 4.1 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 4.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 9.5 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.5 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 23.4 bits (48), Expect = 2.4 Identities = 12/67 (17%), Positives = 26/67 (38%) Frame = +1 Query: 472 DPGQRMRSGIVVANQCNSCRCNADGYGICSGELALNTLSSQRKNVRRRRCGKMNATRVGA 651 D + + GI +++ C +C +C G + ++ +C +A + Sbjct: 41 DSCHKCKYGIAMSSACGIVQCAKGPDELCGGPQNYLGICAEGMQCSCNKCIGCSAEKFEC 100 Query: 652 LRMVNPC 672 + NPC Sbjct: 101 SKTSNPC 107 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 4.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -3 Query: 666 VYHPKCTNTCCIHFSTSSSA 607 ++HP C +H +TSSS+ Sbjct: 400 LHHPNCKINRKVHHTTSSSS 419 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 532 TYNCYTGSPRRSRSA 488 T C+TG PR+S + Sbjct: 296 TVRCFTGGPRKSHES 310 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -2 Query: 739 HSLPWISSDFSGVLLV 692 H L W +S+F+G+ ++ Sbjct: 65 HHLKWNASEFAGIRVI 80 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = -3 Query: 672 TWVYHPKCTNTCCIH 628 TW YH C IH Sbjct: 1676 TWGYHHNVNKHCTIH 1690 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -3 Query: 528 TTVTLVRHDDPGAHS 484 TTV LV DPG H+ Sbjct: 121 TTVELVDATDPGEHN 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,355 Number of Sequences: 438 Number of extensions: 5114 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23875740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -