BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00940 (719 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 23 3.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.1 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +3 Query: 15 DHRPVVMQLGRLLNHDPV 68 D+ P ++LG + HDPV Sbjct: 416 DYTPSSLELGEVAVHDPV 433 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/47 (25%), Positives = 19/47 (40%) Frame = -2 Query: 577 SVALTVGELTGLKPDDVANTDPSRAVFAESTTGSEKRPTEKIRRETQ 437 + L TG P + + A TTG+ PT ++R+ Q Sbjct: 225 TTTLPAASATGTGPATPSAVVATSNATAAMTTGTTTIPTRRLRKRRQ 271 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,242 Number of Sequences: 438 Number of extensions: 4084 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -