BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00939 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 66 2e-11 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 62 6e-10 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 60 2e-09 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 56 3e-08 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 56 3e-08 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 54 9e-08 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 53 3e-07 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 39 0.005 SB_21512| Best HMM Match : HRDC (HMM E-Value=3.5) 34 0.13 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 33 0.30 SB_43382| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 30 2.1 SB_13144| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_26957| Best HMM Match : PDZ (HMM E-Value=0) 29 4.9 SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_32489| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_702| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 66.5 bits (155), Expect = 2e-11 Identities = 30/69 (43%), Positives = 47/69 (68%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+++ PEEIS+K G + ++GKH+ + EHGY + +F R Y LP+ + TV SR++ Sbjct: 45 LDVKNYRPEEISLKVEHGRIKIDGKHKS-EGEHGYETSEFHRSYNLPDGVDVSTVSSRIT 103 Query: 441 SDGVLTVIA 467 DG+L + A Sbjct: 104 GDGLLHIEA 112 Score = 33.9 bits (74), Expect = 0.13 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +3 Query: 384 RRYALPENCNPDTVESRLSSDGVLTVIAPRTPAATKNERAVPSLKPA 524 R + LP++ + D++ SRL DG L + A R T +ER V L+ A Sbjct: 161 RHFVLPKDVDMDSLVSRLGKDGKLYIEAKRILHPTPHERQVNILRDA 207 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 61.7 bits (143), Expect = 6e-10 Identities = 33/87 (37%), Positives = 53/87 (60%), Gaps = 1/87 (1%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ F PEEI+ K +G + V G + + E G+ S++F R Y LPE + ++ +R++ Sbjct: 11 LDVREFKPEEITCKVENGKIKVSGL-QRHESEEGFDSKEFRRCYNLPEGVDESSISTRIA 69 Query: 441 SDGVLTVIA-PRTPAATKNERAVPSLK 518 DG+L V A ++P AT +A P+ K Sbjct: 70 EDGMLHVEALKKSPPATTENKA-PATK 95 Score = 56.0 bits (129), Expect = 3e-08 Identities = 30/74 (40%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYIS-RQFTRRYALPENCNPDTVESRL 437 LDV F PEE+ VK + V + E +EHG+ + RQF R + LP + DT+ RL Sbjct: 104 LDVSDFKPEEVDVKVYGHELSVRARQE--CEEHGFFTARQFNRHFVLPREVDMDTLVPRL 161 Query: 438 SSDGVLTVIAPRTP 479 DGVL + A + P Sbjct: 162 GKDGVLYIEADKRP 175 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/69 (42%), Positives = 44/69 (63%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G V V+G+H + E G+ ++F R + LPE +P+ V SR+S Sbjct: 12 LDVKEYRPEEISFKVENGVVKVQGRH-VNEGEFGFELKEFRRTFTLPEGIDPENVTSRIS 70 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 71 NHGHLHIEA 79 Score = 45.6 bits (103), Expect = 4e-05 Identities = 23/74 (31%), Positives = 38/74 (51%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV F PE I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 102 IDVAGFPPESIKVQVLGNELLVNANHEVEHEGH-YHAMHFNRQFVLPREVDMDSLTTRLD 160 Query: 441 SDGVLTVIAPRTPA 482 +G L A ++ A Sbjct: 161 KEGKLHFEAKKSVA 174 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 56.0 bits (129), Expect = 3e-08 Identities = 27/69 (39%), Positives = 43/69 (62%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G+V V+G+H + G+ ++F R +ALPE V++R+S Sbjct: 12 LDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFALPEGVEASNVKTRIS 70 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 71 NHGQLHIEA 79 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/95 (28%), Positives = 45/95 (47%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV F P+ I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 103 MDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDSLTTRLD 161 Query: 441 SDGVLTVIAPRTPAATKNERAVPSLKPARSGRRLR 545 +G L A +R P+L P R + L+ Sbjct: 162 KEGKLHFEA--------KKRNAPALPPVRELKVLK 188 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 56.0 bits (129), Expect = 3e-08 Identities = 27/69 (39%), Positives = 43/69 (62%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G+V V+G+H + G+ ++F R +ALPE V++R+S Sbjct: 12 LDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFALPEGVEASNVKTRIS 70 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 71 NHGQLHIEA 79 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/95 (28%), Positives = 45/95 (47%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV F P+ I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 103 MDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDSLTTRLD 161 Query: 441 SDGVLTVIAPRTPAATKNERAVPSLKPARSGRRLR 545 +G L A +R P+L P R + L+ Sbjct: 162 KEGKLHFEA--------KKRNAPALPPVRELKVLK 188 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 54.4 bits (125), Expect = 9e-08 Identities = 26/69 (37%), Positives = 42/69 (60%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G+V V+G+H + G+ ++F R + LPE V++R+S Sbjct: 12 LDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 70 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 71 NHGQLHIEA 79 Score = 54.4 bits (125), Expect = 9e-08 Identities = 26/69 (37%), Positives = 42/69 (60%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G+V V+G+H + G+ ++F R + LPE V++R+S Sbjct: 246 LDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 304 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 305 NHGQLHIEA 313 Score = 44.0 bits (99), Expect = 1e-04 Identities = 27/95 (28%), Positives = 45/95 (47%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV F P+ I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 337 MDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDSLTTRLD 395 Query: 441 SDGVLTVIAPRTPAATKNERAVPSLKPARSGRRLR 545 +G L A +R P+L P R + L+ Sbjct: 396 KEGKLHFEA--------KKRNAPALPPVRELKVLK 422 Score = 43.6 bits (98), Expect = 2e-04 Identities = 20/65 (30%), Positives = 34/65 (52%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV F P+ I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 103 MDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDSLTTRLD 161 Query: 441 SDGVL 455 +G L Sbjct: 162 KEGKL 166 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 54.4 bits (125), Expect = 9e-08 Identities = 26/69 (37%), Positives = 42/69 (60%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G+V V+G+H + G+ ++F R + LPE V++R+S Sbjct: 12 LDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 70 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 71 NHGQLHIEA 79 Score = 44.4 bits (100), Expect = 9e-05 Identities = 27/100 (27%), Positives = 47/100 (47%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV F P+ I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 103 MDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDSLTTRLD 161 Query: 441 SDGVLTVIAPRTPAATKNERAVPSLKPARSGRRLRSPLRK 560 +G L A +R P+L P R + L+ + + Sbjct: 162 KEGKLHFEA--------KKRNAPALPPVRELKVLKDNISR 193 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/69 (37%), Positives = 41/69 (59%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 LDV+ + PEEIS K +G V V+G+H + G+ ++F R + LPE V++R+S Sbjct: 13 LDVREYRPEEISFKVENGVVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEASNVKTRIS 71 Query: 441 SDGVLTVIA 467 + G L + A Sbjct: 72 NHGQLHIEA 80 Score = 46.4 bits (105), Expect = 2e-05 Identities = 29/95 (30%), Positives = 46/95 (48%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLS 440 +DV+ F PE I V+ ++V HE + H Y + F R++ LP + D++ +RL Sbjct: 103 MDVKGFPPEAIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFILPREVDMDSLTTRLD 161 Query: 441 SDGVLTVIAPRTPAATKNERAVPSLKPARSGRRLR 545 +G L A +R P+L P R + LR Sbjct: 162 KEGKLHFEA--------KKRNAPALPPVRELKVLR 188 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +3 Query: 261 LDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYI-SRQFTRRYALPE 404 LDV F PEE+ VK + V + E +EHG+ +RQF R + LP+ Sbjct: 32 LDVSDFKPEEVDVKVYGHELSVRARQE--CEEHGFFTARQFNRHFVLPQ 78 >SB_21512| Best HMM Match : HRDC (HMM E-Value=3.5) Length = 191 Score = 33.9 bits (74), Expect = 0.13 Identities = 23/53 (43%), Positives = 26/53 (49%), Gaps = 2/53 (3%) Frame = -1 Query: 677 IKRSVSQARTRNANKINTRYNTF-LIHSVPRVIVL-FRCSQLPQWAP*SPSGP 525 IKRS T N N NTR + L H V R ++L FR LP WA P P Sbjct: 133 IKRSSQFNSTGNINYTNTRMKCYALRHCVNRAVLLKFRALSLPTWAYSIPYQP 185 >SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) Length = 436 Score = 32.7 bits (71), Expect = 0.30 Identities = 12/22 (54%), Positives = 17/22 (77%) Frame = +3 Query: 333 KHEERQDEHGYISRQFTRRYAL 398 KHEER+D HGY+ + T ++AL Sbjct: 72 KHEEREDRHGYLKDKVTLQHAL 93 >SB_43382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 861 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -1 Query: 680 TIKRSVSQARTRNANKI--NTRYNTFLIHSVPRVIVLFRCSQLPQW 549 TIK++V RN+N++ + R+ TFL+ PR+ R QW Sbjct: 425 TIKQTVQGFVMRNSNQMKKDVRFQTFLVICSPRLAEAMRGLDFEQW 470 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 327 EGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLSSDGVLT 458 E K+EE DEHG I R+ T+ TV ++ DGV T Sbjct: 1187 ETKYEEYVDEHGQIIRRTTKVKHTAVKQERTTVTKTVTRDGVTT 1230 >SB_13144| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 266 Score = 29.1 bits (62), Expect = 3.7 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +3 Query: 297 VKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPE 404 +++A GYV+ G H + + G + + R LP+ Sbjct: 10 IRSARGYVVTSGSHTSKSEVRGIMEETCSNRNPLPQ 45 >SB_26957| Best HMM Match : PDZ (HMM E-Value=0) Length = 1685 Score = 28.7 bits (61), Expect = 4.9 Identities = 23/98 (23%), Positives = 38/98 (38%), Gaps = 3/98 (3%) Frame = +3 Query: 267 VQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPENCNPDTVESRLSSD 446 + H+ + T + G+ E + Y+SR TR+ A P + PD S + + Sbjct: 1565 MSHYQASTVLKNTGTSVELALGRSREAAE---YLSR--TRQQASPHSTEPDIKPSNIQTT 1619 Query: 447 GVLTVIAPRTPAATKNERAVP---SLKPARSGRRLRSP 551 I+PR R P + KP+ + SP Sbjct: 1620 ESTPSISPRGVEVAAGPRRTPPPVAPKPSTDSLKRSSP 1657 >SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = -3 Query: 234 GDGGTDVSIGDRHLLPRTVVISGHRWRDDGRQEIVRSKRQSEVLIAKAVRLVSQDEWQQR 55 G G + S G++ + V +WR +G + RS + EV K V + +W+QR Sbjct: 132 GSGDRERSGGEKEVETEKEVEGSRKWRREGSGDRERSGGEKEVETEKEVE--ERRKWRQR 189 >SB_32489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1240 Score = 27.9 bits (59), Expect = 8.6 Identities = 17/57 (29%), Positives = 26/57 (45%) Frame = +1 Query: 157 PTMSRDYYRPWKQMAIANRDVGSTITSNKDKFQST*TFNTFRPKKSQ*RQPTATSSS 327 P+ + + Y P Q AN T +N Q+T ++NT + Q T+T SS Sbjct: 805 PSQTTEAYTPPAQTTEANTPPAQTTEANTPPVQTTESYNTPTETTALPYQETSTESS 861 >SB_702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/27 (55%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +3 Query: 75 GIPTEPPSRSGLRTGAYSGRS-PDGRH 152 G P+ PPSRS RT SG S D RH Sbjct: 853 GKPSTPPSRSKKRTRGISGDSVSDNRH 879 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,692,996 Number of Sequences: 59808 Number of extensions: 419336 Number of successful extensions: 1388 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1384 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -