BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00934 (417 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 25 0.83 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 22 7.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 22 7.8 AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-b... 22 7.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 7.8 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 22 7.8 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 22 7.8 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 25.4 bits (53), Expect = 0.83 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 146 TRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEV 244 T RS ST N TIR R TR P P V Sbjct: 416 TTRSTSTKLSNCSMRTIRTTVRSTRAPSPGPIV 448 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.2 bits (45), Expect = 7.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 82 KQTILDKCNATIKWLDSNQLADKEEYEHKQKELEG 186 K T LD N++I + + +KEE K ++EG Sbjct: 1693 KWTDLDTTNSSILFSYRHNFIEKEERFWKTGQMEG 1727 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.2 bits (45), Expect = 7.8 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 82 KQTILDKCNATIKWLDSNQLADKEEYEHKQKELEG 186 K T LD N++I + + +KEE K ++EG Sbjct: 1694 KWTDLDTTNSSILFSYRHNFIEKEERFWKTGQMEG 1728 >AJ697720-1|CAG26913.1| 207|Anopheles gambiae putative odorant-binding protein OBPjj10 protein. Length = 207 Score = 22.2 bits (45), Expect = 7.8 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -3 Query: 154 PPCRPAGWNPAT 119 PPCR GW +T Sbjct: 50 PPCRVPGWRLST 61 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 7.8 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 265 HPEPEVPPPGLEALAPPSRRSIK 333 H +VPPPG+E P + I+ Sbjct: 1746 HLSFKVPPPGIEFTLPSPKIGIE 1768 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 Query: 154 PPCRPAGWNPAT*WWRCTCRGWSACQS 74 P C PA P CT GW A ++ Sbjct: 1186 PICLPARDAPYLPGQNCTISGWGATEA 1212 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 Query: 154 PPCRPAGWNPAT*WWRCTCRGWSACQS 74 P C PA P CT GW A ++ Sbjct: 1186 PICLPARDAPYLPGQNCTISGWGATEA 1212 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 391,310 Number of Sequences: 2352 Number of extensions: 7538 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34205040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -