BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00931 (368 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0041 - 20169308-20169317,20169485-20170491 27 4.6 03_05_0700 + 26920743-26920771,26920880-26920991,26921205-269213... 26 8.1 >03_05_0041 - 20169308-20169317,20169485-20170491 Length = 338 Score = 27.1 bits (57), Expect = 4.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 156 LAGKLFIQLFSISVNTHYQMNHIPIGCTENSKG*KGTNYY 37 +AG LFI FS+S + + H P+ T+ S K +Y Sbjct: 217 MAGALFIYFFSVSGGMYGIIRHTPMFITDRSDPNKLVFFY 256 >03_05_0700 + 26920743-26920771,26920880-26920991,26921205-26921306, 26921391-26921503,26921858-26921927,26922348-26922425, 26922500-26922616,26922738-26922832,26923080-26923159, 26923405-26923532 Length = 307 Score = 26.2 bits (55), Expect = 8.1 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 25 HDFKIVVCSFSPFGIFCTPNRYM 93 HD I+ C SP FC PNRY+ Sbjct: 221 HDGYILKCLLSPE--FCDPNRYL 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,929,952 Number of Sequences: 37544 Number of extensions: 148854 Number of successful extensions: 249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 576724416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -