Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00931
         (368 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z72502-1|CAA96585.2|  430|Caenorhabditis elegans Hypothetical pr...    29   1.0  
AF000197-5|AAB52900.3|  579|Caenorhabditis elegans Hypothetical ...    26   9.7  

>Z72502-1|CAA96585.2|  430|Caenorhabditis elegans Hypothetical
           protein C08B6.2 protein.
          Length = 430

 Score = 29.1 bits (62), Expect = 1.0
 Identities = 15/46 (32%), Positives = 24/46 (52%)
 Frame = -1

Query: 368 NIKIVFLLRNSYFLKATANILVGTFINVQHTLVLFLYCFIHFMKAF 231
           N  +VFL    +F      I + T ++ ++  VL L+CF H +K F
Sbjct: 357 NFGLVFLNAKIFFGHDFGFIQIITLLDQENFFVLHLFCFYHNIKYF 402


>AF000197-5|AAB52900.3|  579|Caenorhabditis elegans Hypothetical
           protein T21G5.1 protein.
          Length = 579

 Score = 25.8 bits (54), Expect = 9.7
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +2

Query: 284 VHL*RSQPIC*QW 322
           VHL R+QP+C QW
Sbjct: 157 VHLARAQPVCVQW 169


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,460,570
Number of Sequences: 27780
Number of extensions: 155983
Number of successful extensions: 360
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 360
length of database: 12,740,198
effective HSP length: 73
effective length of database: 10,712,258
effective search space used: 524900642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)