BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= wdS00931
(368 letters)
Database: celegans
27,780 sequences; 12,740,198 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
Z72502-1|CAA96585.2| 430|Caenorhabditis elegans Hypothetical pr... 29 1.0
AF000197-5|AAB52900.3| 579|Caenorhabditis elegans Hypothetical ... 26 9.7
>Z72502-1|CAA96585.2| 430|Caenorhabditis elegans Hypothetical
protein C08B6.2 protein.
Length = 430
Score = 29.1 bits (62), Expect = 1.0
Identities = 15/46 (32%), Positives = 24/46 (52%)
Frame = -1
Query: 368 NIKIVFLLRNSYFLKATANILVGTFINVQHTLVLFLYCFIHFMKAF 231
N +VFL +F I + T ++ ++ VL L+CF H +K F
Sbjct: 357 NFGLVFLNAKIFFGHDFGFIQIITLLDQENFFVLHLFCFYHNIKYF 402
>AF000197-5|AAB52900.3| 579|Caenorhabditis elegans Hypothetical
protein T21G5.1 protein.
Length = 579
Score = 25.8 bits (54), Expect = 9.7
Identities = 9/13 (69%), Positives = 11/13 (84%)
Frame = +2
Query: 284 VHL*RSQPIC*QW 322
VHL R+QP+C QW
Sbjct: 157 VHLARAQPVCVQW 169
Database: celegans
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 12,740,198
Number of sequences in database: 27,780
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,460,570
Number of Sequences: 27780
Number of extensions: 155983
Number of successful extensions: 360
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 352
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 360
length of database: 12,740,198
effective HSP length: 73
effective length of database: 10,712,258
effective search space used: 524900642
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -