BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00931 (368 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72502-1|CAA96585.2| 430|Caenorhabditis elegans Hypothetical pr... 29 1.0 AF000197-5|AAB52900.3| 579|Caenorhabditis elegans Hypothetical ... 26 9.7 >Z72502-1|CAA96585.2| 430|Caenorhabditis elegans Hypothetical protein C08B6.2 protein. Length = 430 Score = 29.1 bits (62), Expect = 1.0 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = -1 Query: 368 NIKIVFLLRNSYFLKATANILVGTFINVQHTLVLFLYCFIHFMKAF 231 N +VFL +F I + T ++ ++ VL L+CF H +K F Sbjct: 357 NFGLVFLNAKIFFGHDFGFIQIITLLDQENFFVLHLFCFYHNIKYF 402 >AF000197-5|AAB52900.3| 579|Caenorhabditis elegans Hypothetical protein T21G5.1 protein. Length = 579 Score = 25.8 bits (54), Expect = 9.7 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 284 VHL*RSQPIC*QW 322 VHL R+QP+C QW Sbjct: 157 VHLARAQPVCVQW 169 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,460,570 Number of Sequences: 27780 Number of extensions: 155983 Number of successful extensions: 360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 524900642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -