BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00928 (665 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 28 0.30 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 25 2.8 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 25 2.8 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 24 3.7 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 24 3.7 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 24 5.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.7 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.7 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 27.9 bits (59), Expect = 0.30 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +3 Query: 27 WFEIKKK*CLHSKTAGFNNSGISELVLFHR 116 W E++K+ HSK G + ++E VLFH+ Sbjct: 244 WKEMRKRIDHHSKVYGTMYAKVTECVLFHK 273 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 556 IHRKHTKMLLKSARRK-CSPH 615 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/21 (47%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 556 IHRKHTKMLLKSARRK-CSPH 615 + +KHTK LLK+ K C H Sbjct: 329 VRKKHTKKLLKTTHEKSCGSH 349 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = +1 Query: 193 GGRDEGSDGNRRRT*QRGEEPLSVAYKNVVGARRS 297 GGR +G+DG+R + + S A+++ GA +S Sbjct: 24 GGRYDGADGHRFGYSKPDQRRWSKAHQSCAGAHQS 58 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 24.2 bits (50), Expect = 3.7 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +1 Query: 301 WRVISSIEQKTEGSERKQQMAKEYRVKVEKELREICYDVLGLLDKHLIPKASNPESKV 474 W+V+ ++ + K + + +V K C V L+D LI K NP+ V Sbjct: 274 WKVMKDVKDFIKLLLHKAFIVENQPPQVMKMNTRFCASVRLLIDNALIMKIGNPKVTV 331 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 23.8 bits (49), Expect = 5.0 Identities = 21/78 (26%), Positives = 29/78 (37%) Frame = +3 Query: 114 RPRCPSTRKNWCNVPNWPNKLSDMTTWXXXXXXXXXXASNLATRRGTPFSCL*ECRRCPT 293 RPR PS R N N+P P+ S+ + S+ T T + L CP Sbjct: 126 RPRTPSMRVNCTNIP--PDTSSEEISSEMSAALGVEIFSDQITTVKTHYGTLVAFFDCPA 183 Query: 294 VIMACHFLN*TENRGFRK 347 + + L GF K Sbjct: 184 ITVTDQALARQYTVGFSK 201 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 8.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 322 EQKTEGSERKQQMAKEYRVKVEKELRE 402 EQ+ K+Q KE R K E+E ++ Sbjct: 476 EQREREQREKEQREKEQREKEERERQQ 502 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.0 bits (47), Expect = 8.7 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +2 Query: 107 LPSSTMS-VDKEELVQRAKLAEQAERYDDMAAA 202 LP T + D E+++ +QAE Y DM+ A Sbjct: 649 LPLRTQNKTDAEKILSHVHALKQAEGYIDMSCA 681 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 692,576 Number of Sequences: 2352 Number of extensions: 13454 Number of successful extensions: 39 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -