SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00925
         (825 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock prote...    22   6.8  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     22   6.8  
AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.        22   6.8  
AM295016-1|CAL25731.1|   96|Tribolium castaneum ecdysone recepto...    21   9.0  

>EF633444-1|ABR32189.1|  721|Tribolium castaneum heat shock protein
           90 protein.
          Length = 721

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 14/60 (23%), Positives = 28/60 (46%), Gaps = 2/60 (3%)
 Frame = +1

Query: 121 PKESPVKKSPAKKV--EAAESNGKENGTDEAPEDSPAENGDAEESNEHLRTVMPQKRKRL 294
           P +  V+K   K++  + AE   KE   ++  +D P      E+ +E  +    +K+K +
Sbjct: 210 PIKLVVEKEREKELSDDEAEEEKKEEEGEDKDKDKPKIEDVGEDEDEDTKKEDKKKKKTI 269


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 4/12 (33%), Positives = 10/12 (83%)
 Frame = -2

Query: 800 YWLYHAYVRYYL 765
           YWL+H ++ +++
Sbjct: 599 YWLFHCHIEFHV 610


>AY008296-1|AAG22858.1|  556|Tribolium castaneum Dorsal protein.
          Length = 556

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -2

Query: 497 CRSGICGCELNSN 459
           C+ G+C  E+NS+
Sbjct: 140 CKKGVCTMEINSD 152


>AM295016-1|CAL25731.1|   96|Tribolium castaneum ecdysone receptor
           (isoform B) protein.
          Length = 96

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 10/28 (35%), Positives = 15/28 (53%)
 Frame = +1

Query: 91  VAPEEVTSTEPKESPVKKSPAKKVEAAE 174
           VAPEE +S     S +  SPA  + + +
Sbjct: 9   VAPEESSSEVTSSSALVMSPANSLASTD 36


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,522
Number of Sequences: 336
Number of extensions: 3443
Number of successful extensions: 9
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22621642
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -