BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00924 (738 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 27 0.46 AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 25 3.2 AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-tran... 23 9.8 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 27.5 bits (58), Expect = 0.46 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 472 GEDCDRCLRYLKDR*WIRTVDE 537 G DCDRCL + D W R + Sbjct: 313 GPDCDRCLPFYNDAPWGRATSK 334 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 106 FIRFVKFVDKVLWKQTRNVDDSDTWKRSRRVDVFS 2 F+R+ V K + +Q R+ D + ++R+RRV + S Sbjct: 53 FLRWHNVVAKRVRRQHRDWSDEEIFQRARRVVIAS 87 >AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-transferase D7 protein. Length = 218 Score = 23.0 bits (47), Expect = 9.8 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 216 YFRTVDYFFPT 248 Y R VDY+FPT Sbjct: 107 YQRVVDYYFPT 117 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,614 Number of Sequences: 2352 Number of extensions: 11786 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75676146 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -