BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00922 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93383-2|CAB07624.1| 253|Caenorhabditis elegans Hypothetical pr... 28 5.5 U28731-6|AAA68295.1| 160|Caenorhabditis elegans Hypothetical pr... 28 7.3 U40955-2|AAA81748.2| 89|Caenorhabditis elegans Hypothetical pr... 27 9.6 >Z93383-2|CAB07624.1| 253|Caenorhabditis elegans Hypothetical protein F54B8.2 protein. Length = 253 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 294 IYTPRDRDQNFIIEKNIPPYASHVESLKNHV 202 +Y RDQ+FI++KN AS E+ + ++ Sbjct: 83 VYQSSSRDQSFILQKNFVKVASFCEAFRYYL 113 >U28731-6|AAA68295.1| 160|Caenorhabditis elegans Hypothetical protein F12A10.2 protein. Length = 160 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 139 WNDIILIEYQDCLCVTLLLHLYMIF*TFDMRSIRGDIFFNNKIL 270 WN ++Y+ C+ + L L M M+ + GDI+ N ++ Sbjct: 13 WNSFGGLDYRQCITIMAQLVLAMRIANDKMKFVHGDIYMMNILI 56 >U40955-2|AAA81748.2| 89|Caenorhabditis elegans Hypothetical protein F48B9.4 protein. Length = 89 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 312 FTANLLIYTPRDRDQNFIIEKNIPPYASHV 223 FTAN++ TPR + ++P YA HV Sbjct: 20 FTANVVDATPRSQGNMMRYGNSLPAYAPHV 49 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,573,041 Number of Sequences: 27780 Number of extensions: 251183 Number of successful extensions: 427 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -