BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00922 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 6.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.4 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.4 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.4 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +1 Query: 100 FIKEIILVNGLN*WNDIILI 159 +I+E + NG+ WND + I Sbjct: 46 YIEENNMPNGMQIWNDKVFI 65 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 523 NCVAVSTTGSESRPTEKFRR 582 N A TTG+ + PT + R+ Sbjct: 249 NATAAMTTGTTTIPTRRLRK 268 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 552 GVATYREVPTTFFCVLKSVTNLITLINLLRP 644 G E T CV S++ +TL+ L P Sbjct: 728 GTGNAHETQITTLCVAISLSATVTLVCLYSP 758 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = +3 Query: 552 GVATYREVPTTFFCVLKSVTNLITLINLLRP 644 G E T CV S++ +TL+ L P Sbjct: 818 GTGNAHETQITTLCVAISLSATVTLVCLYSP 848 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,562 Number of Sequences: 438 Number of extensions: 3304 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -