BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00921 (732 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 27 2.8 SPAC2F3.05c |||xylose and arabinose reductase |Schizosaccharomyc... 27 2.8 SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr... 27 3.6 SPAC6G10.03c |||abhydrolase family protein, unknown biological r... 26 4.8 SPBC3F6.03 |trr1|caf4|thioredoxin reductase Trr1|Schizosaccharom... 25 8.4 SPBC354.07c |||oxysterol binding protein |Schizosaccharomyces po... 25 8.4 SPAC823.15 |ppa1||minor serine/threonine protein phosphatase Ppa... 25 8.4 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 27.1 bits (57), Expect = 2.8 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +2 Query: 158 FSIYLPPQAEGGDVKLPLLYY 220 F+ Y+PP+ GGD+ +P +Y Sbjct: 20 FNGYVPPEQNGGDIVVPKDFY 40 >SPAC2F3.05c |||xylose and arabinose reductase |Schizosaccharomyces pombe|chr 1|||Manual Length = 275 Score = 27.1 bits (57), Expect = 2.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +1 Query: 274 RYAAEHGVIVVGPDTSPRGVKIDGDDSSWDFGVS 375 RY + G IV+ ++PR +K +GD +DF +S Sbjct: 219 RYCLQRGFIVLPKSSTPRRIKENGD--VFDFEIS 250 >SPBC2D10.14c |myo51||myosin type V|Schizosaccharomyces pombe|chr 2|||Manual Length = 1471 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +2 Query: 263 LVSRGMQPNMV*LS*VLILRHVELRLMEMIHHG 361 L+S +QPN++ L+ +L+H+ R + + HG Sbjct: 1285 LISSALQPNLLELTISHMLQHIGQRAFQTLIHG 1317 >SPAC6G10.03c |||abhydrolase family protein, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 428 Score = 26.2 bits (55), Expect = 4.8 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +3 Query: 510 MGHSMGGHGALVSTLRNPGQYKSVSAFAPICNP 608 +GHSMGG+ + V ++ P + + + +P+ P Sbjct: 177 VGHSMGGYLSAVYAMQYPERVEKLLLVSPVAIP 209 >SPBC3F6.03 |trr1|caf4|thioredoxin reductase Trr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 322 Score = 25.4 bits (53), Expect = 8.4 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +1 Query: 298 IVVGPDTSPRGVKIDGDDSSWDFGVSA 378 +++ S R + I G+D+ W G+SA Sbjct: 115 VILATGASARRLHITGEDTYWQAGISA 141 >SPBC354.07c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 399 Score = 25.4 bits (53), Expect = 8.4 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -2 Query: 473 AFKIKSYNSTFK*L-PIL*LLFHGSFVASK*KPALTPKSHDESSP 342 A + K+Y + K L PIL LF+GS+ +SK K LT + P Sbjct: 98 ASRNKNYGTEKKPLNPILGELFYGSWDSSKGKVELTAEQVSHHGP 142 >SPAC823.15 |ppa1||minor serine/threonine protein phosphatase Ppa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 309 Score = 25.4 bits (53), Expect = 8.4 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 299 ITPCSAAYLWKPDLV*SFVHYKLDQTNNIEVVISHHPLLPEG 174 I+P A Y + PD+ +F H N ++++ H L+ EG Sbjct: 211 ISPRGAGYTFGPDIAEAFNH-----NNGLDLIARAHQLVMEG 247 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,373,555 Number of Sequences: 5004 Number of extensions: 75908 Number of successful extensions: 182 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 182 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 345237368 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -