BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00921 (732 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45116| Best HMM Match : EGF (HMM E-Value=0) 29 2.9 SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_51027| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_43322| Best HMM Match : Peptidase_S9 (HMM E-Value=0.032) 28 9.0 >SB_45116| Best HMM Match : EGF (HMM E-Value=0) Length = 2023 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +1 Query: 418 NYRMGSYLNVELYDLILKAFCNVVDP 495 N++ GS N +LYD K+F +V DP Sbjct: 1973 NFKFGSSKNAQLYDATCKSFGDVRDP 1998 >SB_5694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1113 Score = 29.1 bits (62), Expect = 3.9 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +1 Query: 340 DGDDSSWDFGVSAGFYLDATNEPWNN--NYRMGSYLNVEL 453 D D +W + G + AT E NN +YR+G + VEL Sbjct: 1057 DNDRYNWQRPFTKGKFASATGEKINNPRDYRVGDIIGVEL 1096 >SB_51027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 648 LGEDKSKWAEWDATELVKKYNGPPLT 725 +GE K+ +A W ELVK GP T Sbjct: 276 IGELKNMFARWGIPELVKSDGGPQFT 301 >SB_43322| Best HMM Match : Peptidase_S9 (HMM E-Value=0.032) Length = 216 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 504 WYMGHSMGGHGALVSTLRNPGQYKSVSAFAP 596 + GHSMGG A+++ R P +K V AP Sbjct: 69 YLFGHSMGGLIAVLAAQRRPTFFKGVVLSAP 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,051,699 Number of Sequences: 59808 Number of extensions: 565233 Number of successful extensions: 1272 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1269 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -