BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00921 (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 3.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.2 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.0 bits (47), Expect = 3.0 Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -2 Query: 242 HYKLDQTNNIEVVISHHPLLPE-GGDR*KNSFCI 144 H L++TNNI +++ P+L E DR +N + Sbjct: 259 HSILNRTNNIFELVTVEPILTERPSDRQRNEILL 292 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +1 Query: 316 TSPRGVKIDGDDSSWDFGVSAGFYLDATNEP 408 T+P G +I+ + DFG A F + P Sbjct: 305 TAPLGAEIEPSTQTIDFGRPATFTCNVRGNP 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,476 Number of Sequences: 438 Number of extensions: 5510 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -