BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00919 (731 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC005179-1|AAH05179.1| 202|Homo sapiens COMM domain containing ... 43 0.001 AY542165-1|AAS22247.1| 202|Homo sapiens COMMD10 protein. 43 0.001 AK002147-1|BAA92108.1| 202|Homo sapiens protein ( Homo sapiens ... 43 0.001 >BC005179-1|AAH05179.1| 202|Homo sapiens COMM domain containing 10 protein. Length = 202 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +3 Query: 117 IRITPGLTKGIHLINLLELSRFEQFLNRILVKLKMNNNEVFSQEEQKSSQNCLKSTKK 290 +R +P + K + LIN ++ RF + L RIL KL + FS+EE++ Q K+ Sbjct: 9 LRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQ 66 >AY542165-1|AAS22247.1| 202|Homo sapiens COMMD10 protein. Length = 202 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +3 Query: 117 IRITPGLTKGIHLINLLELSRFEQFLNRILVKLKMNNNEVFSQEEQKSSQNCLKSTKK 290 +R +P + K + LIN ++ RF + L RIL KL + FS+EE++ Q K+ Sbjct: 9 LRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQ 66 >AK002147-1|BAA92108.1| 202|Homo sapiens protein ( Homo sapiens cDNA FLJ11285 fis, clone PLACE1009571. ). Length = 202 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +3 Query: 117 IRITPGLTKGIHLINLLELSRFEQFLNRILVKLKMNNNEVFSQEEQKSSQNCLKSTKK 290 +R +P + K + LIN ++ RF + L RIL KL + FS+EE++ Q K+ Sbjct: 9 LRESPSMKKAVSLINAIDTGRFPRLLTRILQKLHLKAESSFSEEEEEKLQAAFSLEKQ 66 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,970,576 Number of Sequences: 237096 Number of extensions: 1607607 Number of successful extensions: 2612 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2612 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -