BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00919 (731 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.8 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 9.0 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 9.0 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/57 (22%), Positives = 26/57 (45%) Frame = +3 Query: 123 ITPGLTKGIHLINLLELSRFEQFLNRILVKLKMNNNEVFSQEEQKSSQNCLKSTKKA 293 I PG+T G+H+++ + + V+ ++N ++ E S +K T A Sbjct: 11 ILPGITIGVHILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSAPRVKKTASA 67 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.8 Identities = 13/57 (22%), Positives = 26/57 (45%) Frame = +3 Query: 123 ITPGLTKGIHLINLLELSRFEQFLNRILVKLKMNNNEVFSQEEQKSSQNCLKSTKKA 293 I PG+T G+H+++ + + V+ ++N ++ E S +K T A Sbjct: 101 ILPGITIGVHILDTCGRDTYALNQSLHFVRASLSNLDMSVLECADRSAPRVKKTASA 157 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = +2 Query: 617 IQSYIPCLLIL 649 IQ Y+PC+LI+ Sbjct: 249 IQVYVPCVLIV 259 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 9.0 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = +1 Query: 58 KILRIAWIQYIWKERC 105 +IL + W+ IW+ C Sbjct: 77 RILDVDWLHNIWRPDC 92 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,559 Number of Sequences: 438 Number of extensions: 3469 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -